PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.L5CJ5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family G2-like
Protein Properties Length: 459aa    MW: 50878.1 Da    PI: 7.424
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.L5CJ5genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like103.21.6e-32306361156
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                  k+r++W+peLH+rFv+a+++LGGs++AtPk+i+elm+v+gLt+++vkSHLQkYRl+
  Araip.L5CJ5 306 KQRRCWSPELHRRFVNALQKLGGSQVATPKQIRELMQVDGLTNDEVKSHLQKYRLH 361
                  79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.4E-18303364IPR009057Homeodomain-like
PROSITE profilePS5129414.461303363IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.1E-29304364IPR009057Homeodomain-like
TIGRFAMsTIGR015572.1E-27306361IPR006447Myb domain, plants
PfamPF002494.9E-8308359IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 459 aa     Download sequence    Send to blast
MGSVPAELSL DIRPPTPPPP PPPSTPSFIP KTITDFLSAL STTGITASEK QSRINDFLSH  60
LEDEYNKIHA FKRELPLSML LLSDEELEKC SEGERKSEPV LEVFIPLKRE FDHSEDDEEH  120
NNNNNNDNNN NNNNIRQEKE CRDKMSWMSS VQLWNASSST TLNNNNNNNA FDNNHKHHHQ  180
NHHHKFGTKK NQEFVVENPF QSHSNVRNNG GRGFMPFTSY TSCSVPVTTV ALSATKEEKE  240
DIGAINRLPL LTPAAAGGGV KTLREGSGSS GSRTSSNNRP VSTSSPPAAA HRTAMMPLQP  300
QQTARKQRRC WSPELHRRFV NALQKLGGSQ VATPKQIREL MQVDGLTNDE VKSHLQKYRL  360
HTRRVPSGSG NHSHNHNQSV VVLGGLWMSQ GQDQCNDSSK GSSSGSGSPQ SPLHLATRSR  420
GGMSPAEADD SMEDDEDAKS ESYSWKSHTH HKQVKVVDV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016180977.10.0PREDICTED: myb-like protein A
TrEMBLA0A072UPI81e-144A0A072UPI8_MEDTR; Myb-like transcription factor family protein
STRINGGLYMA02G15320.11e-125(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF120834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.12e-36G2-like family protein